|

shree dakshinaamoorti stotram'

No ratings
0 views
shree dakshinaamoorti stotram'

pralambitajat'aabaddham' chandrarekhaavatam'sakam' |
neelagreevam' sharachchandrachandrikaabhirviraajitam' || 1 ||

goksheeradhaval'aakaaram' chandrabimbasamaananam' |
susmitam' suprasannam' cha svaatmatattvaikasam'sthitam' || 2 ||

gangaadharam' shivam' shaantam' lasatkeyooramand'itam' |
sarvaabharanasam'yuktam' sarvalakshanasam'yutam' || 3 ||

veeraasane samaaseenam' vedayajnyopaveetinam' |
bhasmadhaaraabhiraamam' tam' naagaabharanabhooshitam' || 4 ||

vyaaghracharmaambaram' shuddham' yogapat't'aavri'tam' shubham' |
sarveshaam' praaninaamaatmajnyaanaapasmaarapri'sht'hatah' || 5 ||

vinyastacharanam' samyagjnyaanamudraadharam' haram' |
sarvavijnyaanaratnaanaam' koshabhootam' supustakam' || 6 ||

dadhaanam' sarvatattvaakshamaalikaam' kund'ikaamapi |
svaatmabhootaparaanandaparaashaktyardhavigraham' || 7 ||

dharmaroopavri'shopetam' dhaarmikairvedapaaragaih' |
munibhih' sam'vri'tam' maayaavat'amoolaashritam' shubham' || 8 ||

eeshaanam' sarvavidyaanaameeshvareshvaramavyayam' |
utpattyaadivinirmuktamonkaarakamalaasanam' || 9 ||

svaatmavidyaapradaanena sadaa sam'saaramochakam' |
rudram' paramakaarunyaatsarvapraanihite ratam' || 10 ||

upaasakaanaam' sarveshaamabheesht'asakalapradam' |
dakshinaamoortidevaakhyam' jagatsargaadikaaranam' || 11 ||

samaagatya mahaabhaktyaa dand'avatpri'thiveetale |
pranamya bahusho devam' samaaraadhya yathaabalam' || 12 ||

rudra yatte mukham' tena dakshinam' paahi maamiti |
uktvaa punah' punardevam' poojayaamaasa bhaktitah' || 13 ||

iti shreeskaandapuraane sootasam'hitaayaam' muktikhand'e
chaturtho'dhyaaye shree dakshinaamoorti stotram' ||

Meaning

Dakshinamurthy is Shiva turned to the south, teaching without speaking - the guru of gurus, seated under the tree with the chin mudra. This stotram of thirteen-odd verses carries a colophon placing it in the Skanda Purana, Suta Samhita, Mukti Khanda. It is a dhyana stotra: verse after verse simply sets out his form so the reciter can hold the picture steady while chanting.

Significance

One thing to settle first, because search results mix them up constantly. This is not Adi Shankara's Dakshinamurti Stotram, the famous ten verses beginning vishvam darpana drishyamana nagari tulyam with the refrain tasmai shri gurumurtaye nama idam shri dakshinamurtaye. Shankara's poem argues advaita in compressed metaphors - the world seen as a city in a mirror. The Puranic stotram here does something else: it paints. Matted hair, the crescent on the head, the throat darkened from the poison, a complexion the verses compare to cow's milk. Both are called Dakshinamurthy Stotram and both are worth reciting; they are simply different texts.

Why recite a description? Because in this tradition the form is the teaching. Dakshinamurthy answers nothing aloud - the doubt of the sanaka-and-brothers dissolves in his silence, and the raised thumb touching the forefinger says what a lecture could not. So devotees who want clarity in study, in teaching, or in a decision they cannot think their way through come to this form. Tradition holds that steady recitation brings jnana and clears the fog around learning. It is not sold as a shortcut past work.

How and when to chant

Thursday is the natural day - guruvara, the day of the teacher - and Guru Purnima in Ashada is the occasion when it is recited most. Students take it up before an examination or at the start of a new course of study; teachers, before they begin the year.

Morning, after a bath, is the usual time. Because the murti faces south, the devotee sits facing north, which is also the direction tradition assigns to study. In a Shiva temple you will find Dakshinamurthy in the niche on the outer south wall; devotees going round the sanctum stop there, and many recite the stotram standing at that niche rather than at the main shrine. At home, a lamp with sesame oil, white flowers, and plain recitation is enough - no elaborate upachara is prescribed for this text. Some read it eleven times on a Thursday; others keep to once a day for forty-eight days. Neither count comes from the stotram itself.

Frequently Asked Questions

Is this the same as Adi Shankara's Dakshinamurti Stotram?
No, and the confusion is common. Shankara's is ten verses beginning vishvam darpana drishyamana nagari tulyam, each ending tasmai shri gurumurtaye nama idam shri dakshinamurtaye. This text is longer, Puranic, and descriptive rather than philosophical - its colophon places it in the Skanda Purana, Suta Samhita, Mukti Khanda. Different compositions, same deity.
Why does Dakshinamurthy face south?
South is the direction of Yama and of what people fear, and it is the direction a teacher faces when the student sits in the north. Tradition reads the south-facing posture both ways: the teacher who looks steadily at death, and the guru positioned so the disciple receives instruction in the proper direction. In temples he occupies the outer south wall niche.
Which day and occasion suit this stotram?
Thursday, the guru's day, and Guru Purnima in the month of Ashada. Students recite it before beginning a syllabus or sitting an examination, and teachers at the start of a term. Pradosha and Shivaratri also apply since the deity is Shiva, though the guru occasions are the ones traditionally tied to this form.
What does the chin mudra mean?
The thumb and forefinger touch to form a circle while the other three fingers stay open. The common reading: the forefinger is the individual self, the three fingers the body, mind and senses that must be let go of, and the thumb the supreme. When the two meet, the separation was never real. Dakshinamurthy teaches this with the hand, not the voice.
Can students recite it before examinations?
That is one of its most common uses in Kannada households - a Thursday recitation through the exam season, often with the books kept before the lamp. Tradition holds that it steadies the mind and sharpens retention. It is prayed for clarity, not for marks, and no text promises results without study.
Do I need initiation from a guru to recite it?
No. This is a Puranic stotra in the public domain of recitation, not a mantra requiring diksha. Anyone may read it. Those who have a guru naturally offer the recitation at his feet on Guru Purnima; those who do not simply recite before the form of Dakshinamurthy, who is himself described as the guru of all gurus.
What form of Shiva do the verses describe?
Matted hair bound up, the crescent moon on the head, the throat dark from the poison he swallowed, and a complexion the verses compare to the whiteness of cow's milk. He is seated, youthful in appearance though ancient, with elders as disciples before him. Holding that picture while chanting is the whole point of a dhyana stotra.

Comments

Please login to leave a comment

Loading comments...